
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acheta domesticus (House cricket)
Uniprot NO.:P29870
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MATWSNLNLQNSSSPLMEQLIFFHDHTLMILLMITVLVAYIMSMLFFNLYTNRFLLEGQT IEIIWTILPAITLIFIALPSLRLLYLLDESMDPLITMKTIGHQWYWSYEYMDFKNIIEFD SYMSALDKLSSFRLLDVDNRTILPMNTQIRTLVTAADVIHSWTVSALGVKTDATPGRLNQ INFMINRPGLFYGQCSEICGANHSFMPIVIESVNLKNFINWIKNYSS
Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II
Gene Names:Name:COII
Expression Region:1-227
Sequence Info:full length protein
You may also like
-
Recombinant Cytochrome c oxidase subunit 2(COII)
- Regular price
- $1,336.00 USD
- Sale price
- $1,336.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cytochrome c oxidase subunit 2
- Regular price
- $1,350.00 USD
- Sale price
- $1,350.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cytochrome c oxidase subunit 1(COI)
- Regular price
- $1,318.00 USD
- Sale price
- $1,318.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pisaster ochraceus Cytochrome c oxidase subunit 2(COII)
- Regular price
- $1,339.00 USD
- Sale price
- $1,339.00 USD
- Regular price
-
- Unit price
- per
Sold out