
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acanthamoeba polyphaga mimivirus (APMV)
Uniprot NO.:Q5UR99
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDNTHLIESSLRHQFLTMFRTDNAFIDGILTVMIISLLSYIVKQFSDLPSVIGNIYNKIM IKIRLFFRPKSADKISKTTIIESLSEDKKPNELYTAVYWFLTTNIDLTVDSNVKMSFTKK IELDEYKELKDKNINKNMSYGTKKIFNYTHNNMTFEIEYFFATNLVSVYTDKKRDKENHI IYLTTLIDPNIRFDVFEEFTKMCMREYAKSLVDKKWVQKIFTNNNGRWTETVFITDVNLN SYFA
Protein Names:Recommended name: Uncharacterized protein L573
Gene Names:Ordered Locus Names:MIMI_L573
Expression Region:1-244
Sequence Info:full length protein
You may also like
-
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L536(MIMI_L536)
- Regular price
- $1,292.00 USD
- Sale price
- $1,292.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R557(MIMI_R557)
- Regular price
- $1,284.00 USD
- Sale price
- $1,284.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R571(MIMI_R571)
- Regular price
- $1,407.00 USD
- Sale price
- $1,407.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L778(MIMI_L778)
- Regular price
- $1,372.00 USD
- Sale price
- $1,372.00 USD
- Regular price
-
- Unit price
- per
Sold out