Recombinant Rhodoferax ferrireducens  NADH-quinone oxidoreductase subunit A(nuoA)

Recombinant Rhodoferax ferrireducens NADH-quinone oxidoreductase subunit A(nuoA)

CSB-CF636500RAAJ
Regular price
£868.00 GBP
Sale price
£868.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodoferax ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118)

Uniprot NO.:Q21YC7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLDQYLPIFLFILVGIGVGVAPQVLGYILGPNLPDSAKNSPYECGFEAFGDARMKFDVR YYLVAILFILFDLEIAFLFPWAVALKDIGALGFWSVMVFLTILVVGFIYEWKKGALDWE

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1

Gene Names:Name:nuoA Ordered Locus Names:Rfer_1493

Expression Region:1-119

Sequence Info:full length protein

Your list is ready to share