Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oxyopes takobius Oxyopinin-4a

Recombinant Oxyopes takobius Oxyopinin-4a

SKU:CSB-EP520732OGA

Regular price £797.00 GBP
Regular price Sale price £797.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: F8J4S0

Gene Names: N/A

Organism: Oxyopes takobius (Lynx spider) (Oxyopes foliiformis)

AA Sequence: GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF

Expression Region: 48-77aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 19.6 kDa

Alternative Name(s): Oxt-4a

Relevance: Disrupts cell membranes through the formation of pores (Probable). Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10 µM) and B.subtilis (MIC=0.5 µM) as well as Gram-negative bacteria P.fluorescens (MIC=1 µM) and E.coli (MIC=0.5 µM). Has hemolytic activity against human erythrocytes (EC(50)=7 µM)

Reference: "Novel lynx spider toxin shares common molecular architecture with defense peptides from frog skin."Dubovskii P.V., Vassilevski A.A., Samsonova O.V., Egorova N.S., Kozlov S.A., Feofanov A.V., Arseniev A.S., Grishin E.V.FEBS J. 278:4382-4393(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details