Gene Bio Systems
Recombinant Human Ubiquitin-conjugating enzyme E2 D4(UBE2D4)
Recombinant Human Ubiquitin-conjugating enzyme E2 D4(UBE2D4)
SKU:CSB-EP896498HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: Q9Y2X8
Gene Names: UBE2D4
Organism: Homo sapiens (Human)
AA Sequence: MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM
Expression Region: 1-147aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 43.6 kDa
Alternative Name(s): E2 ubiquitin-conjugating enzyme D4 HBUCE1 Ubiquitin carrier protein D4 Ubiquitin-protein ligase D4
Relevance: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.
Reference: "Molecular cloning and screening of two ubiquitin conjugation enzymes." Li G., Jin J., Hu S., Li W., Yuan J., Qiang B. Submitted (JAN-1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.