Recombinant Human Myosin regulatory light chain 2, atrial isoform(MYL7)

Recombinant Human Myosin regulatory light chain 2, atrial isoform(MYL7)

CSB-EP889545HU
Regular price
£422.00 GBP
Sale price
£422.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q01449

Gene Names: MYL7

Organism: Homo sapiens (Human)

AA Sequence: MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE

Expression Region: 1-175aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 46.4 kDa

Alternative Name(s): Myosin regulatory light chain 7

Relevance:

Reference: "Differential regulation of the atrial isoforms of the myosin light chains during striated muscle development." Hailstones D.L., Barton P., Chan-Thomas P., Sutherland C.J., Hardeman E.C., Gunning P.W. J. Biol. Chem. 267:23295-23300(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share