Gene Bio Systems
Recombinant Human LIM domain transcription factor LMO4(LMO4)
Recombinant Human LIM domain transcription factor LMO4(LMO4)
SKU:CSB-EP013011HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: P61968
Gene Names: LMO4
Organism: Homo sapiens (Human)
AA Sequence: MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Expression Region: 1-165aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 45 kDa
Alternative Name(s): Breast tumor autoantigen LIM domain only protein 4
Relevance: Probable transcriptional factor.
Reference: "Molecular cloning of LMO4, a new human LIM domain gene." Racevskis J., Dill A., Sparano J.A., Ruan H. Biochim. Biophys. Acta 1445:148-153(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
