Gene Bio Systems
Recombinant Arbacia lixula Cytochrome c oxidase subunit 3(COIII)
Recombinant Arbacia lixula Cytochrome c oxidase subunit 3(COIII)
SKU:CSB-CF657733ANK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arbacia lixula (Black urchin) (Echinus lixula)
Uniprot NO.:Q33752
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AGNRTEAVQALFLTVALGIYFTILQAWEYYDSPFTIADSVYGSTFFVATGFHGLHVINST TFLLVCLFRLINFHFSAHHHFGFEAAAWYWDFVDVVVAFSLYMHIWWGS
Protein Names:Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide III
Gene Names:Name:COIII
Expression Region:1-109
Sequence Info:full length protein