View larger

Recombinant NADH-ubiquinone oxidoreductase chain 6(ND6)

CSB-CF657794EZF

Recombinant NADH-ubiquinone oxidoreductase chain 6(ND6)

See below for Detailed Description

More details

CAD$1,553.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Prototheca wickerhamii

Uniprot NO.:Q37626

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDFLFYIFSSLTLISGSLVIQARNPVHSVLFLVLVFFNAAGLLVLLGLDFFALIFLVVYV GAIAVLFLFVVMMLNIRITEISEKRLRYLPVGGVLGVLFLFEICILIDNDCIPLLSYDIE NTALLANYNQLSFIDWRMYLSTSHTIDALGSLLYTYYFYFFLVASLILLVAMIGAIVLTM QKGIRIKRQQVFLQNTRDFAKTIRKVA

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 6 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 6

Gene Names:Name:ND6 Synonyms:NAD6

Expression Region:1-207

Sequence Info:full length protein

30 other products in the same category: