View larger

Recombinant Nocardia farcinica Probable cytochrome c oxidase subunit 3(ctaE)

CSB-CF726446NAAA

Recombinant Nocardia farcinica Probable cytochrome c oxidase subunit 3(ctaE)

See below for Detailed Description

More details

CAD$1,549.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Nocardia farcinica (strain IFM 10152)

Uniprot NO.:Q5YZ19

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTAVGTPGSAITQRVHSLNRPNMVSVGTIIWLSSELMFFAGLFAMYFVARAQANGNWPP EPTELNLKLAVPVTAVLVASSFTCQMGVFAAEKGDVFGLRRWYFITLLMGAFFVAGQGYE YYHLVHEGTSISSSAYGSVFYITTGFHGLHVIGGLIAFVFLLIRTKVSKFTPAQATAAIV VSYYWHFVDIVWIGLFATIYFVR

Protein Names:Recommended name: Probable cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 3 Cytochrome c oxidase polypeptide III

Gene Names:Name:ctaE Ordered Locus Names:NFA_17260

Expression Region:1-203

Sequence Info:full length protein

30 other products in the same category: