View larger

Recombinant Shigella boydii serotype 4 Putative leucine efflux protein(leuE)

CSB-CF654024SGE

Recombinant Shigella boydii serotype 4 Putative leucine efflux protein(leuE)

See below for Detailed Description

More details

CAD$1,537.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shigella boydii serotype 4 (strain Sb227)

Uniprot NO.:Q321T8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVPGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIKTTPILFNIVRY LGAFYLLYLESKILYATLKGKNNEAKSDEPQYGAIFKRALILSLTNPKAILFYVSFFVQF IDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFV GFAARLATLQS

Protein Names:Recommended name: Putative leucine efflux protein

Gene Names:Name:leuE Ordered Locus Names:SBO_1292/SBO_1294

Expression Region:1-191

Sequence Info:full length protein

30 other products in the same category: