View larger

Recombinant Rat Prenylated Rab acceptor protein 1(Rabac1)

CSB-CF019227RA

Recombinant Rat Prenylated Rab acceptor protein 1(Rabac1)

See below for Detailed Description

More details

CAD$1,530.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:O35394

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAQKDQQKDAEVEGLSATTLLPKLIPSGAGREWLERRRATIRPWGTFVDQQRFSRPRNV GELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLQSKLV LFGREVSPAHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVLIGSHAAFHQIEPADGEEL QMEPV

Protein Names:Recommended name: Prenylated Rab acceptor protein 1 Alternative name(s): PRA1 family protein 1

Gene Names:Name:Rabac1 Synonyms:Pra1, Praf1

Expression Region:1-185

Sequence Info:Full length protein

30 other products in the same category: