Recombinant Yellow fever virus Genome polyprotein

SKU: CSB-CF338998YAB

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yellow fever virus (isolate Peru/1899/1981) (YFV)

Uniprot NO.:P29165

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSGRKAQGKTLGVNMVRQGVRSLSNKIKQKTKQIGNRPGPSRGVQGFIFFFLFNVLTGRK ITAHLKKLWRMLDPRQGLAVLKKVKRVVASLMRGLSSRKRR

Protein Names:Recommended name: Genome polyproteinCleaved into the following 7 chains: 1. Capsid protein CAlternative name(s): Core protein prM Peptide pr Small envelope protein MAlternative name(s): Matrix protein Envelope protein E Non-stru

Gene Names:

Expression Region:1-101

Sequence Info:full length protein