Gene Bio Systems
Recombinant Yellow fever virus Genome polyprotein
Recombinant Yellow fever virus Genome polyprotein
SKU:CSB-CF338998YAB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yellow fever virus (isolate Peru/1899/1981) (YFV)
Uniprot NO.:P29165
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSGRKAQGKTLGVNMVRQGVRSLSNKIKQKTKQIGNRPGPSRGVQGFIFFFLFNVLTGRK ITAHLKKLWRMLDPRQGLAVLKKVKRVVASLMRGLSSRKRR
Protein Names:Recommended name: Genome polyproteinCleaved into the following 7 chains: 1. Capsid protein CAlternative name(s): Core protein prM Peptide pr Small envelope protein MAlternative name(s): Matrix protein Envelope protein E Non-stru
Gene Names:
Expression Region:1-101
Sequence Info:full length protein
