Gene Bio Systems
Recombinant Shigella flexneri Invasin (IpaD)
Recombinant Shigella flexneri Invasin (IpaD)
SKU:CSB-EP325954SZB
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Microbiology
Uniprot ID: P18013
Gene Names: ipaD
Organism: Shigella flexneri
AA Sequence: MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDTLHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRNEYPINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALEELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQKNGGYVVSINMTPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFLHF
Expression Region: 1-332aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 56.6 kDa
Alternative Name(s): 36KDA membrane antigen
Relevance: Required for bacterial invasion of host cells. Controls IpaB and IpaC secretion, and the efficiency with which they are physically inserted into target cell membranes. These proteins are exported via TTSS to form a pore in the host membrane that allows the translocation of the other effectors into the host cytoplasm. Along with IpaB, is essential for both blocking secretion through the Mxi/Spa translocon in the absence of a secretion-inducing signal, and for controlling the level of secretion in the presence of this signal
Reference: "Characterization of invasion plasmid antigen genes (ipaBCD) from Shigella flexneri."Venkatesan M.M., Buysse J.M., Kopecko D.J.Proc. Natl. Acad. Sci. U.S.A. 85:9317-9321(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
