Gene Bio Systems
Recombinant Rat Hereditary hemochromatosis protein homolog(Hfe)
Recombinant Rat Hereditary hemochromatosis protein homolog(Hfe)
SKU:CSB-CF010323RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:O35799
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QALRPGSHSLRYLFMGASKPDLGLPFFEALGYVDDQLFVSYNHESRRAEPRAPWILGQTSSQLWLQLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLRVVPESHILQVILGCEVHEDNSTSGFWKYGYDGQDHLEFCPKTLNWSAAEPRAWATKMEWEEHRIRARQSRDYLQRDCPQQLKQVLELQRGVLGQQVPTLVKVTRHWASTGTSLRCQALNFFPQNITMRWLKDSQPLDAKDVNPENVLPNGDGTYQGWLTLAVAPGEETRFSCQVEHPGLDQPLTATWEPSRSQDMIIGIISGITICAIFFVGILILVLRKRKVSGGTMGDYVLTECE
Protein Names:Recommended name: Hereditary hemochromatosis protein homolog Alternative name(s): RT1-CAFE
Gene Names:Name:Hfe
Expression Region:26-360
Sequence Info:full length protein
