Recombinant Porcine respiratory coronavirus Envelope small membrane protein(E)

SKU: CSB-CF304836PQE

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Porcine respiratory coronavirus (strain RM4) (PRCoV) (PRCV)

Uniprot NO.:P69610

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTFPRALTVIDDNGMVISIIFWFLLIIILILLSIALLNIIKLCMVCCNLGRTVIIVPVQH AYDAYKNFMRIKAYNPDGALLV

Protein Names:Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein Alternative name(s): ORF 3 Protein 4 Protein X1

Gene Names:Name:E Synonyms:NS4

Expression Region:1-82

Sequence Info:full length protein