Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pectobacterium carotovorum subsp. carotovorum Protein mopB(mopB)

Recombinant Pectobacterium carotovorum subsp. carotovorum Protein mopB(mopB)

SKU:CSB-CF341499ESP

Regular price $2,076.20 CAD
Regular price Sale price $2,076.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora)

Uniprot NO.:P34199

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAIASISSPAPVASQQSTLVTEPPLTSSMLLTQVGSVLAGILLFILLIAWLARKLGFAPQ AKQNKLLKVVSSCPVGQRERVVIVEVDNTWLVLGVTAQQITPLHTLPAQPTNDSSSTGDT KPVDFNQLLKKVLKRPEKSE

Protein Names:Recommended name: Protein mopB

Gene Names:Name:mopB

Expression Region:1-140

Sequence Info:full length protein

View full details