Gene Bio Systems
Recombinant Pectobacterium carotovorum subsp. carotovorum Protein mopB(mopB)
Recombinant Pectobacterium carotovorum subsp. carotovorum Protein mopB(mopB)
SKU:CSB-CF341499ESP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora)
Uniprot NO.:P34199
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAIASISSPAPVASQQSTLVTEPPLTSSMLLTQVGSVLAGILLFILLIAWLARKLGFAPQ AKQNKLLKVVSSCPVGQRERVVIVEVDNTWLVLGVTAQQITPLHTLPAQPTNDSSSTGDT KPVDFNQLLKKVLKRPEKSE
Protein Names:Recommended name: Protein mopB
Gene Names:Name:mopB
Expression Region:1-140
Sequence Info:full length protein
