Gene Bio Systems
Recombinant Mouse C-X-C motif chemokine 2 protein(Cxcl2)
Recombinant Mouse C-X-C motif chemokine 2 protein(Cxcl2)
SKU:CSB-RP092274m
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P10889
Gene Names: Cxcl2
Organism: Mus musculus (Mouse)
AA Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Expression Region: 28-100aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 11.8 kDa
Alternative Name(s): Macrophage inflammatory protein 2 ;MIP2
Relevance: Chotactic for human polymorphonuclear leukocytes but does not induce chokinesis or an oxidative burst.
Reference: Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues.Tekamp-Olson P., Gallegos C., Bauer D., McClain J., Sherry B., Fabre M., van Deventer S., Cerami A.J. Exp. Med. 172:911-919(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
