Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Thymic stromal lymphopoietin(TSLP)

Recombinant Human Thymic stromal lymphopoietin(TSLP)

SKU:CSB-EP025141HU

Regular price $992.60 CAD
Regular price Sale price $992.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: Q969D9

Gene Names: TSLP

Organism: Homo sapiens (Human)

AA Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Expression Region: 29-159aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 30.9 kDa

Alternative Name(s):

Relevance: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells.

Reference: "Human thymic stromal lymphopoietin preferentially stimulates myeloid cells."Reche P.A., Soumelis V., Gorman D.M., Clifford T., Liu M.-R., Travis M., Zurawski S.M., Johnston J., Liu Y.-J., Spits H., de Waal Malefyt R., Kastelein R.A., Bazan J.F.J. Immunol. 167:336-343(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details