Recombinant Human Orexin receptor type 1(HCRTR1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Orexin receptor type 1(HCRTR1)

CSB-YP010231HU
Regular price
$1,029.92 CAD
Sale price
$1,029.92 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Metabolism

Uniprot ID: O43613

Gene Names: HCRTR1

Organism: Homo sapiens (Human)

AA Sequence: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE

Expression Region: 1-46aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

MW: 21.4 kDa

Alternative Name(s): Hypocretin receptor type 1

Relevance: Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca2+ levels in response to orexin-A binding

Reference: "Structure and ligand-binding mechanism of the human OX1 and OX2 orexin receptors." Yin J., Babaoglu K., Brautigam C.A., Clark L., Shao Z., Scheuermann T.H., Harrell C.M., Gotter A.L., Roecker A.J., Winrow C.J., Renger J.J., Coleman P.J., Rosenbaum D.M. Nat. Struct. Mol. Biol. 23:293-299(2016)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share