Gene Bio Systems
Recombinant Human Mitochondrial inner membrane protease subunit 2(IMMP2L)
Recombinant Human Mitochondrial inner membrane protease subunit 2(IMMP2L)
SKU:CSB-CF822306HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q96T52
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVL LNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRYVKVPRGHIWV EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQKLESVLPPERLPVQREEE
Protein Names:Recommended name: Mitochondrial inner membrane protease subunit 2 EC= 3.4.21.- Alternative name(s): IMP2-like protein
Gene Names:Name:IMMP2L
Expression Region:1-175
Sequence Info:full length protein