Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Immunity-related GTPase family M protein(IRGM)

Recombinant Human Immunity-related GTPase family M protein(IRGM)

SKU:CSB-EP011827HU

Regular price $886.25 CAD
Regular price Sale price $886.25 CAD
Sale Sold out
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: A1A4Y4

Gene Names: IRGM

Organism: Homo sapiens (Human)

AA Sequence: MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY

Expression Region: 1-178aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 47.1 kDa

Alternative Name(s): Immunity-related GTPase family M protein 1 Interferon-inducible protein 1 LPS-stimulated RAW 264.7 macrophage protein 47 homolog

Relevance: Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility

Reference: "Death and resurrection of the human IRGM gene." Bekpen C., Marques-Bonet T., Alkan C., Antonacci F., Leogrande M.B., Ventura M., Kidd J.M., Siswara P., Howard J.C., Eichler E.E. PLoS Genet. 5:E1000403-E1000403(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)