Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Glycophorin-B(GYPB)

Recombinant Human Glycophorin-B(GYPB)

SKU:CSB-CF010075HU

Regular price $1,763.75 CAD
Regular price Sale price $1,763.75 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P06028

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA

Protein Names:Recommended name: Glycophorin-B Alternative name(s): PAS-3 SS-active sialoglycoprotein Sialoglycoprotein delta CD_antigen= CD235b

Gene Names:Name:GYPB Synonyms:GPB

Expression Region:20-91

Sequence Info:full length protein

View full details