Recombinant Human Calcium/calmodulin-dependent protein kinase II inhibitor 1(CAMK2N1)

SKU: CSB-EP004469HU

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:Q7Z7J9

Gene Names:CAMK2N1

Organism:Homo sapiens (Human)

AA Sequence:MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV

Expression Region:1-78aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 6xHis-Trx-tagged

MW:25.6 kDa

Alternative Name(s):CaMKII inhibitory protein alpha (CaMKIIN-alpha)

Relevance:Potent and specific inhibitor of CaM-kinase II.

Reference:"Human gingiva transcriptome during wound healing." Wang Y., Tatakis D.N. J. Clin. Periodontol. 44:394-402(2017)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Potent and specific inhibitor of CaM-kinase II (CAMK2).

Involvement in disease:

Subcellular Location:Cell junction, synapse, synaptosome, Cell junction, synapse, postsynaptic cell membrane, postsynaptic density

Protein Families:CAMK2N family

Tissue Specificity:Widely expressed. Nor detected in skeletal muscle.

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:24190

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=731383

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:55450

STRING Database Link:

OMIM Database Link:https://www.omim.org/entry/614986614986614986

Lead Time Guidance:3-7 business days