Gene Bio Systems
Recombinant Human C-Myc-binding protein(MYCBP)
Recombinant Human C-Myc-binding protein(MYCBP)
SKU:CSB-EP858710HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: Q99417
Gene Names: MYCBP
Organism: Homo sapiens (Human)
AA Sequence: AHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Expression Region: 2-103aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 27.8 kDa
Alternative Name(s): Associate of Myc 1 ;AMY-1
Relevance: May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.
Reference: AMY-1, a novel C-MYC binding protein that stimulates transcription activity of C-MYC.Taira T., Maeda J., Ohishi T., Kitaura H., Yoshida S., Kato H., Ikeda M., Tamai K., Iguchi-Ariga S.M.M., Ariga H.Genes Cells 3:549-565(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
