Skip to product information
1 of 1

Gene Bio Systems

Recombinant His1 virus Uncharacterized protein ORF20(ORF20)

Recombinant His1 virus Uncharacterized protein ORF20(ORF20)

SKU:CSB-CF635624HAAR

Regular price $2,072.00 CAD
Regular price Sale price $2,072.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:His1 virus (isolate Australia/Victoria) (His1V) (Haloarcula hispanica virus 1)

Uniprot NO.:Q25BH5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSSKWNMITELFLGAANSYAQMRGKITHYEIQHDGTIQHEFIDPSNTEEKAWDLEDNPE QQISVKGYANSCTLTVKDDSNEVELVPSGRYKQYMENQILSQTMQTGSMDSQKMMYLSIA NLATLLLFGIIGLSIIT

Protein Names:Recommended name: Uncharacterized protein ORF20

Gene Names:ORF Names:ORF20

Expression Region:1-137

Sequence Info:full length protein

View full details