Skip to product information
1 of 1

Gene Bio Systems

Recombinant Glycerol-3-phosphate acyltransferase(plsY)

Recombinant Glycerol-3-phosphate acyltransferase(plsY)

SKU:CSB-CF373505RIZ

Regular price $2,160.20 CAD
Regular price Sale price $2,160.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ruthia magnifica subsp. Calyptogena magnifica

Uniprot NO.:A1AXL0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLPELLFIVLLLLSYLIGSISTAIIVCKMFNLPDSRTQGSNNPGATNVLRIGGKKAAAIT LIGDGLKGAIPVLIAHYLAFNMLNVTWVILVTFLGHVYPIFFSFKGGKGVATFLGALLAL SYLTGLSFIITWVFVAKVLKISSLSALISTVLTPVYFYLITNNLASTYVIILICLWIFYT HQSNIKRLLNSQENKIN

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati

Gene Names:Name:plsY Ordered Locus Names:Rmag_0958

Expression Region:1-197

Sequence Info:full length protein

View full details