Recombinant Escherichia coli Translocated intimin receptor Tir(tir),partial

SKU: CSB-EP514896EOF

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: C6UYL8

Gene Names: tir

Organism: Escherichia coli O157:H7 (strain TW14359 / EHEC)

AA Sequence: QALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELKVSSGAG

Expression Region: 252-362aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 27.8 kDa

Alternative Name(s): Secreted effector protein Tir

Relevance: Multifunctional protein that is required for efficient pedestal formation in host epithelial cells during infection. The Extracellular domain region acts as a receptor for bacterial intimin, allowing the bacterium to attach tightly to the host-cell surface. Simultaneously, the intracellular region initiates a signaling cascade in the host cell, which leads to actin polymerization and formation of actin pedestals at the sites of bacterial adhesion

Reference: "Analysis of the genome of the Escherichia coli O157:H7 2006 spinach-associated outbreak isolate indicates candidate genes that may enhance virulence."Kulasekara B.R., Jacobs M., Zhou Y., Wu Z., Sims E., Saenphimmachak C., Rohmer L., Ritchie J.M., Radey M., McKevitt M., Freeman T.L., Hayden H., Haugen E., Gillett W., Fong C., Chang J., Beskhlebnaya V., Waldor M.K. Miller S.I.Infect. Immun. 77:3713-3721(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.