Skip to product information
1 of 1

Gene Bio Systems

Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial

Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial

SKU:CSB-EP335461EFB1

Regular price $1,269.80 CAD
Regular price Sale price $1,269.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P29362

Gene Names: LMP1

Organism: Epstein-Barr virus (strain Cao) (HHV-4) (Human herpesvirus 4)

AA Sequence: YYHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPHSPSDSAGNDGGPPNLTEEVANKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Expression Region: 185-404aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 29.8 kDa

Alternative Name(s): Protein p63

Relevance: Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. It is a short-lived protein probably degraded by the proteasome

Reference: "Evolutionarily conserved herpesviral protein interaction networks." Fossum E., Friedel C.C., Rajagopala S.V., Titz B., Baiker A., Schmidt T., Kraus T., Stellberger T., Rutenberg C., Suthram S., Bandyopadhyay S., Rose D., von Brunn A., Uhlmann M., Zeretzke C., Dong Y.A., Boulet H., Koegl M.Haas J. PLoS Pathog. 5:e1000570-e1000570(2009)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details