Skip to product information
1 of 1

Gene Bio Systems

Recombinant Enterobacteria phage T4 Lysozyme(E)

Recombinant Enterobacteria phage T4 Lysozyme(E)

SKU:CSB-EP360435EDZ

Regular price $1,492.40 CAD
Regular price Sale price $1,492.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: P00720

Gene Names: E

Organism: Enterobacteria phage T4 (Bacteriophage T4)

AA Sequence: MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL

Expression Region: 1-164aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 34.6 kDa

Alternative Name(s): Lysis protein Lysozyme Muramidase

Relevance: Endolysin with lysozyme activity that degrades host peptidoglycans and participates with the holin and spanin proteins in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles. Once the holin has permeabilized the host cell membrane, the endolysin can reach the periplasm and break down the peptidoglycan layer.

Reference: "Protein determinants of phage T4 lysis inhibition."Moussa S.H., Kuznetsov V., Tran T.A., Sacchettini J.C., Young R.Protein Sci. 21:571-582(2012)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details