Gene Bio Systems
Recombinant Enterobacteria phage T4 Lysozyme(E)
Recombinant Enterobacteria phage T4 Lysozyme(E)
SKU:CSB-EP360435EDZ
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Microbiology
Uniprot ID: P00720
Gene Names: E
Organism: Enterobacteria phage T4 (Bacteriophage T4)
AA Sequence: MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL
Expression Region: 1-164aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 34.6 kDa
Alternative Name(s): Lysis protein Lysozyme Muramidase
Relevance: Endolysin with lysozyme activity that degrades host peptidoglycans and participates with the holin and spanin proteins in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles. Once the holin has permeabilized the host cell membrane, the endolysin can reach the periplasm and break down the peptidoglycan layer.
Reference: "Protein determinants of phage T4 lysis inhibition."Moussa S.H., Kuznetsov V., Tran T.A., Sacchettini J.C., Young R.Protein Sci. 21:571-582(2012)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
