Skip to product information
1 of 1

Gene Bio Systems

Recombinant Enterobacteria phage M13 (Bacteriophage M13) Tail virion protein G9P

Recombinant Enterobacteria phage M13 (Bacteriophage M13) Tail virion protein G9P

SKU:CSB-EP301675ECY

Regular price $1,492.40 CAD
Regular price Sale price $1,492.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: P69538

Gene Names: IX

Organism: Enterobacteria phage M13 (Bacteriophage M13)

AA Sequence: MSVLVYSFASFVLGWCLRSGITYFTRLMETSS

Expression Region: 1-32aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 19.7 kDa

Alternative Name(s): Coat protein C, polypeptide II G9P

Relevance: May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.

Reference: "Nucleotide sequence of the filamentous bacteriophage M13 DNA genome: comparison with phage fd."van Wezenbeek P.M.G.F., Hulsebos T.J.M., Schoenmakers J.G.G.Gene 11:129-148(1980)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details