Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bradyrhizobium japonicum Large-conductance mechanosensitive channel(mscL)

Recombinant Bradyrhizobium japonicum Large-conductance mechanosensitive channel(mscL)

SKU:CSB-CF803730BVW

Regular price $2,073.40 CAD
Regular price Sale price $2,073.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bradyrhizobium japonicum (strain USDA 110)

Uniprot NO.:Q89K46

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKEFREFAMKGNVVDLAVGVIIGAAFGAIVTSLVGDVIMPLIGAVTGGLDFSNYFTPLS KAVTATNLADAKKQGAVLAWGSFLTLTINFIIIAFVLFLVIRAINTLKRKEEAAPAAPPK PSAEVELLTEIRDLLKKS

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:bll5071

Expression Region:1-138

Sequence Info:full length protein

View full details