Gene Bio Systems
Recombinant Bacillus tusciae Cobalt transport protein CbiM(cbiM)
Recombinant Bacillus tusciae Cobalt transport protein CbiM(cbiM)
SKU:CSB-CF522157BRT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bacillus tusciae (strain DSM 2912 / NBRC 15312 / T2)
Uniprot NO.:D5WSC8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHIMEGYLPLGWCLFWAALCLPALILGTRSLQKQVGDNLRMKLVLALSAAFAFVLSALKL PSVTGSSSHPTGVGLGAVLFGPMAMSVVGCIILLFQALLLAHGGITTLGANTFSMAVVGP TVSYVVFRIFQKSGFGRGVAVFLAAALGDLSTYLTTSLQLALAFPAPIGGVASSFWKFAS IFAVTQVPLAVSEGLLTVIMVNWVMKYSPEVLSRAMNLPEEGHHEA
Protein Names:Recommended name: Cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM
Gene Names:Name:cbiM Ordered Locus Names:Btus_0236
Expression Region:22-247
Sequence Info:full length protein
