Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis UPF0344 protein yisL(yisL)

Recombinant Bacillus subtilis UPF0344 protein yisL(yisL)

SKU:CSB-CF519158BRJ

Regular price $2,044.00 CAD
Regular price Sale price $2,044.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O06725

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTHLHITTWVVALILLFVSYSLYSSGSAKGAKITHMILRLFYILIILTGAELFVRFANWN GEYAGKMILGIITIGLMEMLLIRKKKEKSTGGLWVGFVIVLLLTVLLGLHLPIGFQLF

Protein Names:Recommended name: UPF0344 protein yisL

Gene Names:Name:yisL Ordered Locus Names:BSU10760

Expression Region:1-118

Sequence Info:full length protein

View full details