Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aquifex aeolicus Uncharacterized protein aq_850 (aq_850)

Recombinant Aquifex aeolicus Uncharacterized protein aq_850 (aq_850)

SKU:CSB-CF527786DNV

Regular price $2,073.40 CAD
Regular price Sale price $2,073.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Aquifex aeolicus (strain VF5)

Uniprot NO.:O67017

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALKKLRFEDILLGLTLSLTFLYPLIITLIILYQDAKRKEKEMKIFQKVENIFLSKRCRE RILEIVPYLEFVSDSFIEKLIKVCEFTSGKKPKDKEYKNLEEESLYLIELERGTLKVLGK WISDEEFKLLLITYEPKT

Protein Names:Recommended name: Uncharacterized protein aq_850

Gene Names:Ordered Locus Names:aq_850

Expression Region:1-138

Sequence Info:full length protein

View full details