Gene Bio Systems
Recombinant Aquifex aeolicus Uncharacterized protein aq_850 (aq_850)
Recombinant Aquifex aeolicus Uncharacterized protein aq_850 (aq_850)
SKU:CSB-CF527786DNV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aquifex aeolicus (strain VF5)
Uniprot NO.:O67017
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MALKKLRFEDILLGLTLSLTFLYPLIITLIILYQDAKRKEKEMKIFQKVENIFLSKRCRE RILEIVPYLEFVSDSFIEKLIKVCEFTSGKKPKDKEYKNLEEESLYLIELERGTLKVLGK WISDEEFKLLLITYEPKT
Protein Names:Recommended name: Uncharacterized protein aq_850
Gene Names:Ordered Locus Names:aq_850
Expression Region:1-138
Sequence Info:full length protein
