Skip to product information
1 of 1

Gene Bio Systems

Recombinant Zygosaccharomyces rouxii Genetic interactor of prohibitin 7, mitochondrial(GEP7)

Recombinant Zygosaccharomyces rouxii Genetic interactor of prohibitin 7, mitochondrial(GEP7)

SKU:CSB-CF509515ZBL

Regular price ¥285,500 JPY
Regular price Sale price ¥285,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)

Uniprot NO.:C5DT30

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TQASSRLPPKSLLIKQADRIRRSKDGQADGSKLMVSSLKDIASMFQANAETPEDEEREIL NQQNYLRQQIESGELERLLQDKFNLDESISLMSTNLLVQQFPKLNAQQVELIQEAVSMDS NKHWNEIPQYMKQLQFYFAFGSHGPRLSIPFNSREKPLDFAFKIPSPVTTDGQTKIHKLK PSHLVNLHTITDQRSKIFQTTKLDPATRCILWSAILVSIVFGVQEWRLQQDPQAKITVLS NSV

Protein Names:Recommended name: Genetic interactor of prohibitin 7, mitochondrial

Gene Names:Name:GEP7 Ordered Locus Names:ZYRO0C04972g

Expression Region:16-258

Sequence Info:full length protein

View full details