Recombinant Zea mays V-type proton ATPase 16 kDa proteolipid subunit

SKU: CSB-CF677069ZAX

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Zea mays (Maize)

Uniprot NO.:Q41773

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VPVVMAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIV GDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD

Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit

Gene Names:

Expression Region:1-109

Sequence Info:full length protein