Skip to product information
1 of 1

Gene Bio Systems

Recombinant Zea mays Cell number regulator 6(CNR6)

Recombinant Zea mays Cell number regulator 6(CNR6)

SKU:CSB-CF467294ZAX

Regular price ¥283,800 JPY
Regular price Sale price ¥283,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Zea mays (Maize)

Uniprot NO.:B6SGC5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEDATSSHPSRYVKLTKDQDAPAEDIRPGELNQPVHVPQLEGRRCSECGQVLPESYEPP ADEPWTTGIFGCTDDPETCRTGLFCPCVLFGRNVEAVREDIPWTTPCVCHAVFVEGGITL AILTAIFHGVDPRTSFLIGEGLVFSWWLCATYTGIFRQGLQRKYHLKNSPCDPCMVHCCL HWCANCQEHRERTGRLAENNAVPMTVVNPPPVQEMSMLEEVEEKGAEKSEHDDVEVIPL

Protein Names:Recommended name: Cell number regulator 6 Alternative name(s): ZmCNR06

Gene Names:Name:CNR6

Expression Region:1-239

Sequence Info:full length protein

View full details