
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: L
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Zaire ebolavirus (strain Kikwit-95) (ZEBOV)
Delivery time: 3-7 business days
Uniprot ID: Q6V1Q2
AA Sequence: RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 625-809aa
Protein length: Partial
MW: 27.9 kDa
Alternative Name(s): Large structural protein
Relevance: RNA-directed RNA polymerase that catalyzes the transcription of viral mRNAs, their capping and polyadenylation. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The viral polymerase binds to the genomic RNA at the 3' leader promoter, and transcribes subsequently all viral mRNAs with a decreasing efficiency. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein acts as a processivity factor. Capping is concommitant with initiation of mRNA transcription. Indeed, a GDP polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both activities being carried by the viral polymerase. Polyadenylation of mRNAs occur by a stuttering mechanism at a slipery stop site present at the end viral genes. After finishing transcription of a mRNA, the polymerase can resume transcription of the downstream gene.
Reference: 0
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Zaire ebolavirus RNA-directed RNA polymerase L(L),partial
- Regular price
- ¥158,300 JPY
- Sale price
- ¥158,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Zaire ebolavirus RNA-directed RNA polymerase L(L),partial
- Regular price
- ¥158,300 JPY
- Sale price
- ¥158,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Zaire ebolavirus Nucleoprotein(NP),partial
- Regular price
- ¥158,300 JPY
- Sale price
- ¥158,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Zaire ebolavirus Minor nucleoprotein VP30(VP30)
- Regular price
- ¥158,300 JPY
- Sale price
- ¥158,300 JPY
- Regular price
-
- Unit price
- per
Sold out