Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yop proteins translocation protein R(yscR)

Recombinant Yop proteins translocation protein R(yscR)

SKU:CSB-CF303214YAH

Regular price ¥279,300 JPY
Regular price Sale price ¥279,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Yersinia pseudotuberculosis

Uniprot NO.:P69981

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIQLPDEINLIIVLSLLTLLPLISVMATSFVKFAVVFSLLRNALGVQQIPPNMAMYGLAI ILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPYRMFLKQHIQAQEYSFFVD STKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFLIYLPFIVIDLVISNILLAMG MMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG

Protein Names:Recommended name: Yop proteins translocation protein R

Gene Names:Name:yscR Ordered Locus Names:pYV0071

Expression Region:1-217

Sequence Info:full length protein

View full details