
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Uniprot NO.:A7FP02
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MISTVALFWALCVVCVVNMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVVVSLVALMLWY
Protein Names:Recommended name: Universal stress protein B
Gene Names:Name:uspB Ordered Locus Names:YpsIP31758_4034
Expression Region:1-111
Sequence Info:full length protein
You may also like
-
Recombinant Yersinia pseudotuberculosis serotype O:3 Universal stress protein B(uspB)
- Regular price
- ¥166,700 JPY
- Sale price
- ¥166,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Yersinia pseudotuberculosis serotype IB Universal stress protein B(uspB)
- Regular price
- ¥166,700 JPY
- Sale price
- ¥166,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Universal stress protein B(uspB)
- Regular price
- ¥166,700 JPY
- Sale price
- ¥166,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Yersinia pestis Universal stress protein B(uspB)
- Regular price
- ¥166,700 JPY
- Sale price
- ¥166,700 JPY
- Regular price
-
- Unit price
- per
Sold out