Gene Bio Systems
Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE(yopE)
Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE(yopE)
SKU:CSB-CF330087YQA
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 10ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: yopE
Biologically active: Not Tested
Expression system: in vitro E.coli expression system
Species of origin: Yersinia enterocolitica
Delivery time: 3-7 business days
Uniprot ID: P31492
AA Sequence: MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM
Tag info: N-terminal 6xHis-tagged
Expression Region: 1-219aa
Protein length: Full Length
MW: 26.9 kDa
Alternative Name(s):
Relevance: Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis
Reference: "Secretion of Yop proteins by Yersiniae."Michiels T., Wattiau P., Brasseur R., Ruysschaert J.M., Cornelis G.Infect. Immun. 58:2840-2849(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
