Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yaba-like disease virus E3 ubiquitin-protein ligase LAP(5L)

Recombinant Yaba-like disease virus E3 ubiquitin-protein ligase LAP(5L)

SKU:CSB-CF887621YAAO

Regular price ¥268,300 JPY
Regular price Sale price ¥268,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yaba-like disease virus (YLDV)

Uniprot NO.:Q9DHV7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDICWICNDVCDERNNFCGCNEEYKVVHIKCMQLWINYSKKKECNLCKTKYNIKKTYVS FKKWNWCFNDKKTTLFKIFFILFALVFIFLTITLSNDMANLVTGINDLICSIIFLIVYTV VMLTSICFSVFVVAIVVDFLLEAKEKNSFLTIREIV

Protein Names:Recommended name: E3 ubiquitin-protein ligase LAP EC= 6.3.2.- Alternative name(s): Leukemia associated protein Short name= LAP

Gene Names:Name:5L

Expression Region:1-156

Sequence Info:full length protein

View full details