Gene Bio Systems
Recombinant Xylella fastidiosa UPF0394 membrane protein PD_1893(PD_1893)
Recombinant Xylella fastidiosa UPF0394 membrane protein PD_1893(PD_1893)
SKU:CSB-CF801300XAT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Uniprot NO.:Q87AD3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLHFYSTLRFTVALAAGLLFGFGLALSEMINPIRVLSFLNVASGHWNPSLLFVLGSALA VAFPGMALQRRLKRPLLDECFHLPSKKVIDRRIVFGSAIFGTGWGLTGLCPGPAIASLST GLGSVLLFVAAMAAGMIIHDRIVVRSLS
Protein Names:Recommended name: UPF0394 membrane protein PD_1893
Gene Names:Ordered Locus Names:PD_1893
Expression Region:1-148
Sequence Info:full length protein
