Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Transmembrane protein 17B(Tmem17-b)

Recombinant Xenopus tropicalis Transmembrane protein 17B(Tmem17-b)

SKU:CSB-CF522283XBF

Regular price ¥279,900 JPY
Regular price Sale price ¥279,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:F6RWY9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALLTPLPGSVRHGLARISGSLFIQNKTRDCGEQHAYQSGHDLLSSLPLQMMLYFNAFFF PFWIISEIITMELKFGRLSGYYQILLTTSLVILTLVESLRLYIGYVGNLHEKVPELAGFL ILTLLIQLPLLLFLLTDNRNLLLPLDLAVHMIYLMFINAEIVISFLVLKTMTRQFALEYY LQQSEILVSKHVPVNRTLLRFQNTTTSIAEQYGSDALMY

Protein Names:Recommended name: Transmembrane protein 17B

Gene Names:Name:Tmem17-b

Expression Region:1-219

Sequence Info:full length protein

View full details