Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Transmembrane protein 147(tmem147)

Recombinant Xenopus tropicalis Transmembrane protein 147(tmem147)

SKU:CSB-CF023717XBF

Regular price ¥272,600 JPY
Regular price Sale price ¥272,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q28FY5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWRCVQAGATYLCVQLCKMLFLATFFPTW EGAVGAYDFIGEFMKATVDLADLLGLHLVMSRNAGKGEYKIMVAAMGWATAELVMSRCLP LWVGARGIEFDWKYIQMSIDSNISLVHYMAVAALVWMWTRYDLPTHYRLPVTVLLGLSMY KAFLMDCFVHIFIMGSWTALLLKAVITGVLSLSCLTLFVSLVHGN

Protein Names:Recommended name: Transmembrane protein 147

Gene Names:Name:tmem147 ORF Names:TGas054a07.1

Expression Region:1-225

Sequence Info:full length protein

View full details