Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(sdhd)

Recombinant Xenopus tropicalis Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(sdhd)

SKU:CSB-CF747401XBF

Regular price ¥264,500 JPY
Regular price Sale price ¥264,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q6P355

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LLIRPVPCLTQDHHMVQTSQIHTSPNHHAGSKAASMHWTSERALSVALLGLLPAAYLYPG AAMDYSLAAALTLHGHWGLGQVVTDYVHGDAKIKMANTSLFALSALTFAGLCYFNYHDVG ICKAVSMLWSL

Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): Succinate dehydrogenase complex subunit D Succinate-ubiquinone oxidoreductase cytochrome b small subu

Gene Names:Name:sdhd ORF Names:TNeu097k19.1

Expression Region:22-152

Sequence Info:full length protein

View full details