Gene Bio Systems
Recombinant Xenopus tropicalis Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y(pigy)
Recombinant Xenopus tropicalis Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y(pigy)
SKU:CSB-CF017988XBF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:P0C1P1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:PVILWDPSLLPTDNKTQSSIKLKWGTYQEMLRHKCWLNGKAPKADLGCTEIHHQEWCKMA
Protein Names:Recommended name: Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y Alternative name(s): Phosphatidylinositol-glycan biosynthesis class Y protein Short name= PIG-Y
Gene Names:Name:pigy
Expression Region:1-71
Sequence Info:full length protein
