Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis NEDD4 family-interacting protein 1(ndfip1)

Recombinant Xenopus tropicalis NEDD4 family-interacting protein 1(ndfip1)

SKU:CSB-CF690137XBF

Regular price ¥271,800 JPY
Regular price Sale price ¥271,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q4V786

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEQSSSRYQQLQNEEEPGENPQASTDAPPPYSSIAGESSGLFDYKDELGFPKPPSYNVA TSLPSYDEAERTKAEATIPLVPGRDDDFVARDDFDDADQLRIGNDGIFMLTFFMAFLFNW IGFFLSFCLTSSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFL LFLRGFINYAKVRKMPDNFSTLPRTRVLFIY

Protein Names:Recommended name: NEDD4 family-interacting protein 1

Gene Names:Name:ndfip1

Expression Region:1-211

Sequence Info:full length protein

View full details