Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis N-acetyltransferase 14(nat14)

Recombinant Xenopus tropicalis N-acetyltransferase 14(nat14)

SKU:CSB-CF638965XBF

Regular price ¥277,600 JPY
Regular price Sale price ¥277,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q28DI5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPFIDENQLSVREMREEEAPVVLEMLKDGFKDTENRLILYILTRPMTLLLMAVASSGLRF ILNSFSVALVIPVLLTIVGLKLLLWRSPDLKQIYSYYSIGQRKIWVAVYDQDDICGCVAL EPTQDHQTVELKRMSVSRWYRRSGVGTHLLKFFEDHAKKKGFRGIVLYTSVVAKAAIGLF KNCGYKVTGGWNWLGYTIVQEFRKDI

Protein Names:Recommended name: N-acetyltransferase 14 EC= 2.3.1.-

Gene Names:Name:nat14 ORF Names:TEgg081i20.1

Expression Region:1-206

Sequence Info:full length protein

View full details